| Id: | acc4605 |
| Group: | 1sens |
| Protein: | Smad3 |
| Gene Symbol: | Smad3 |
| Protein Id: | Q8BUN5 |
| Protein Name: | SMAD3_MOUSE |
| PTM: | phosphorylation |
| Site: | Ser204 |
| Site Sequence: | QMNHSMDAGSPNLSPNPMSPA |
| Disease Category: | Respiratory system diseases |
| Disease: | Asthma |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Atrial natriuretic peptide (ANP) |
| Drug Info: | Atrial natriuretic peptide (ANP) is a peptide hormone secreted by the heart. It plays a role in regulating blood volume and blood pressure. |
| Effect: | modulate |
| Effect Info: | "ANP inhibits the phosphorylation of Smad3 by activating the cGMP/PKG pathway, blocks its nuclear translocation, and inhibits the EMT process induced by TGF-β1, thereby alleviating airway remodeling and showing potential in anti - asthma." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 31496319 |
| Sentence Index: | 31496319_14 |
| Sentence: | "In a murine model of allergic asthma, ANP could inhibit TGF-beta1-induced EMT of bronchial epithelial cells through cGMP/PKG signaling, targeting TGF-beta1/Smad3 via attenuating phosphorylation of Smad3 in vitro, which may provide potential of ANP in treating allergic asthma with airway remodeling." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| S | 204 | D | Obesity | Phosphorylation | 29700281 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
