| Id: | acc4674 |
| Group: | 1sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63085 |
| Protein Name: | MK01_MOUSE |
| PTM: | phosphorylation |
| Site: | Tyr187 |
| Site Sequence: | HTGFLTEYVATRWYRAPEIML |
| Disease Category: | Nervous system diseases |
| Disease: | Alzheimer's Disease |
| Disease Subtype: | cognitive dysfunction |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | maslinic acid |
| Drug Info: | "Maslinic acid is a natural triterpenoid compound with potential anti - inflammatory, antioxidant and anti - cancer properties." |
| Effect: | modulate |
| Effect Info: | "Administration of ursolic acid in the mouse hippocampus increased the phosphorylation levels of ERK-CREB, PI3K, and PKB (Akt)." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 32133639 |
| Sentence Index: | 32133639_3 |
| Sentence: | "Previously, we demonstrated that oleanolic acid, which is similar in chemical structure to maslinic acid, ameliorates cognitive impairment through the activation of tropomyosin receptor kinase (TrkB)-ERK-cAMP response element-binding protein (CREB) phosphorylation and increased levels of brain-derived neurotrophic factor (BDNF)." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | D | EL4 thymoma | Phosphorylation | 10753946 |
| T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
| T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
