| Id: | acc4715 |
| Group: | 1sens |
| Protein: | PP2A |
| Gene Symbol: | PTPA |
| Protein Id: | Q15257 |
| Protein Name: | PTPA_HUMAN |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Endothelial Dysfunction |
| Disease Subtype: | |
| Disease Cellline: | HUVECs |
| Disease Info: | |
| Drug: | Angiotensin II |
| Drug Info: | Angiotensin II is a peptide hormone that plays a crucial role in regulating blood pressure and fluid balance. It constricts blood vessels and stimulates the release of aldosterone. |
| Effect: | modulate |
| Effect Info: | "Angiotensin II (AngII) reduces the phosphorylation of endothelial nitric oxide synthase (eNOS) at Ser1177 via the Nox/ROS signaling pathway mediated by AT1R, which in turn leads to a decrease in nitric oxide (NO) content and ultimately causes endothelial dysfunction." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 33162896 |
| Sentence Index: | 33162896_13 |
| Sentence: | The activated PP2A further decreases levels of eNOS Ser1177 phosphorylation and NO content leading to endothelial dysfunction. |
Sequence & Structure:
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
