| Id: | acc4717 |
| Group: | 1sens |
| Protein: | Rac1 |
| Gene Symbol: | Rac1 |
| Protein Id: | P63001 |
| Protein Name: | RAC1_MOUSE |
| PTM: | nitration |
| Site: | Tyr32 |
| Site Sequence: | YTTNAFPGEYIPTVFDNYSAN |
| Disease Category: | Respiratory system diseases |
| Disease: | Acute Lung Injury |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | NipR2 (nitration inhibitor peptide for the Rho GTPases 2) |
| Drug Info: | NipR2 is a nitration inhibitor peptide for the Rho GTPases 2. It may play a role in inhibiting nitration related to Rho GTPases 2. |
| Effect: | modulate |
| Effect Info: | "NipR2 significantly inhibits the nitration modification of Rac1 at the Y32 site, restores its GTPase activity, thereby improving endothelial barrier function, reducing inflammation and pulmonary tissue damage, and improving lung function." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 33248422 |
| Sentence Index: | 33248422_10 |
| Sentence: | "Using a murine model of ALI induced by intratracheal installation of LPS we found that NipR2 successfully prevented Rac1 nitration and Rac1 inhibition, and more importantly attenuated pulmonary inflammation, reduced lung injury and prevented the loss of lung function." |
Sequence & Structure:
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
