| Id: | acc4760 |
| Group: | 1sens |
| Protein: | Smad3 |
| Gene Symbol: | Smad3 |
| Protein Id: | P84025 |
| Protein Name: | SMAD3_RAT |
| PTM: | phosphorylation |
| Site: | Ser423 |
| Site Sequence: | MGSPSIRCSSVS--------- |
| Disease Category: | Urinary and reproductive system diseases |
| Disease: | Renal Fibrosis |
| Disease Subtype: | Obstructive Nephropathy |
| Disease Cellline: | NRK-46F |
| Disease Info: | |
| Drug: | Nintedanib + Gefitinib |
| Drug Info: | Nintedanib is a small molecule tyrosine kinase inhibitor used in treating certain lung diseases. | Gefitinib is an epidermal growth factor receptor (EGFR) tyrosine kinase inhibitor for the treatment of non - small cell lung cancer. |
| Effect: | modulate |
| Effect Info: | Nintedanib and Gefitinib synergistically inhibit the phosphorylation of Smad3 and block the TGF-β1 signaling pathway. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 33614732 |
| Sentence Index: | 33614732_8 |
| Sentence: | "Mechanistically, administration of nintedanib blocked UUO-induced phosphorylation of multiple kinase receptors associated renal fibrosis, including platelet-derived growth factor receptors, fibroblast growth factor receptors, vascular endothelial growth factor receptors, and Src family kinase, while gefitinib inhibited EGFR phosphorylation." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
