Id: acc4771
Group: 1sens
Protein: Smad3
Gene Symbol: Smad3
Protein Id: Q8BUN5
Protein Name: SMAD3_MOUSE
PTM: acetylation
Site: Lys
Site Sequence:
Disease Category: Cardiovascular and circulatory system diseases
Disease: Cardiac Fibrosis
Disease Subtype:
Disease Cellline:
Disease Info:
Drug: isoproterenol
Drug Info: "Isoproterenol is a medication that acts on the sympathetic nervous system, commonly used to treat bradycardia and certain types of shock."
Effect: modulate
Effect Info: Nicotinamide mononucleotide alleviates isoproterenol-induced cardiac fibrosis by inhibiting Smad3 acetylation.
Note:
Score: 4.0
Pubmed(PMID): 33675899
Sentence Index:
Sentence:

Sequence & Structure:

MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS

No data.

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
- - D Chronic kidney disease Phosphorylation 23264657

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: