| Id: | acc4811 |
| Group: | 1sens |
| Protein: | IL-33 |
| Gene Symbol: | Il33 |
| Protein Id: | Q8BVZ5 |
| Protein Name: | IL33_MOUSE |
| PTM: | acetylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Immune system diseases |
| Disease: | Asthma |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | MG149 |
| Drug Info: | MG149 is a drug that may have specific pharmacological effects and applications. |
| Effect: | modulate |
| Effect Info: | "MG149 inhibits the activity of KAT8, reduces the acetylation of IL-33, enhances the ubiquitination and degradation of IL-33, decreases the stability of IL-33, and thereby alleviates airway inflammation and hyperresponsiveness." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 34493712 |
| Sentence Index: | 34493712_0 |
| Sentence: | MG149 inhibits histone acetyltransferase KAT8-mediated IL-33 acetylation to alleviate allergic airway inflammation and airway hyperresponsiveness. |
Sequence & Structure:
MRPRMKYSNSKISPAKFSSTAGEALVPPCKIRRSQQKTKEFCHVYCMRLRSGLTIRKETSYFRKEPTKRYSLKSGTKHEENFSAYPRDSRKRSLLGSIQAFAASVDTLSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
