| Id: | acc4837 |
| Group: | 1sens |
| Protein: | PLN |
| Gene Symbol: | PLN |
| Protein Id: | P26678 |
| Protein Name: | PPLA_HUMAN |
| PTM: | phosphorylation |
| Site: | Thr17 |
| Site Sequence: | TRSAIRRASTIEMPQQARQKL |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Endothelial Cell Angiogenic Damage |
| Disease Subtype: | Hypoxia |
| Disease Cellline: | HUVECs |
| Disease Info: | |
| Drug: | CoCl2 |
| Drug Info: | "CoCl2 is cobalt(II) chloride, a common inorganic compound often used as a reagent in chemical research and as a humidity indicator." |
| Effect: | modulate |
| Effect Info: | CoCl? mimics hypoxic conditions. Hypoxic conditions impair the angiogenic function of human umbilical vein endothelial cells (HUVECs) by activating AMPK and reducing PLN phosphorylation. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 35994824 |
| Sentence Index: | 35994824_13 |
| Sentence: | Hypoxic conditions also reduced the Ca2+ restoration ability of the ER by decreasing sarcoplasmic/endoplasmic reticulum Ca2+ ATPase 2a (SERCA2a) expression and PLN phosphorylationation. |
Sequence & Structure:
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTAC| PLN-Thr17 | |
|---|---|
| Cancer | Intensity |
| BRCA | 1.273 |
| COAD | 0.81 |
| HGSC | -1.259 |
| ccRCC | 0.336 |
| GBM | |
| HNSC | -1.886 |
| LUAD | 0.574 |
| LUSC | 0.474 |
| non_ccRCC | -0.193 |
| PDAC | 0.596 |
| UCEC | -0.724 |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
