| Id: | acc4851 |
| Group: | 1sens |
| Protein: | p53 |
| Gene Symbol: | Tp53 |
| Protein Id: | P10361 |
| Protein Name: | P53_RAT |
| PTM: | phosphorylation |
| Site: | Ser46 |
| Site Sequence: | TGSPNSMEDLFLPQDVAELLE |
| Disease Category: | Nervous system diseases |
| Disease: | Cerebral Ischemia-Reperfusion Injury |
| Disease Subtype: | in the brain of Sprague Dawley rats subjected to t |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | DhHP-3 |
| Drug Info: | "DhHP-3 is a drug, but detailed information about its properties and functions is not provided." |
| Effect: | modulate |
| Effect Info: | "The drug inhibits the phosphorylation level of p53 in the rat model of cerebral ischemia-reperfusion injury (CIRI), suppresses cell apoptosis, and alleviates symptoms." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 36442518 |
| Sentence Index: | 36442518_5 |
| Sentence: | "DhHP-3 could reduce ROS, down-regulate apoptotic proteins, suppress p53 phosphorylation, attenuate the DNA damage response (DDR), and inhibit apoptosis in SH-SY5Y cells subjected to oxygen-glucose deprivation/re-oxygenation (OGD/R) and in the brain of Sprague Dawley rats subjected to transient middle cerebral artery occlusion." |
Sequence & Structure:
MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
