| Id: | acc4864 |
| Group: | 1sens |
| Protein: | Cav3 |
| Gene Symbol: | Cav3 |
| Protein Id: | P51637 |
| Protein Name: | CAV3_MOUSE |
| PTM: | nitration |
| Site: | Tyr73 |
| Site Sequence: | TFTVSKYWCYRLLSTLLGVPL |
| Disease Category: | Endocrine and metabolic diseases |
| Disease: | Diabetes Mellitus |
| Disease Subtype: | cardiac insulin/adiponectin resistance |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | SIN-1 |
| Drug Info: | SIN - 1 is a drug with potential biological activities in relevant pharmacological research. |
| Effect: | modulate |
| Effect Info: | "In cardiomyocytes, SIN - 1 treatment leads to nitration of Cav3, which is a novel mechanism of cardiac insulin resistance in pre - diabetes. Targeting this site can restore cardiac protective function." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 36883479 |
| Sentence Index: | 36883479_16 |
| Sentence: | "Last, diabetic nitrative modification of Cav3 at Tyr73 also reduced Cav3/AdipoR1 complex formation and blocked adiponectin cardioprotective signaling." |
Sequence & Structure:
MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKVSFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSNIKVVLRREG
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
