| Id: | acc4869 |
| Group: | 1sens |
| Protein: | PPARgamma |
| Gene Symbol: | Pparg |
| Protein Id: | P37238 |
| Protein Name: | PPARG_MOUSE |
| PTM: | ubiquitination |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Cardiac Hypertrophy |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | luteolin |
| Drug Info: | "Luteolin is a flavonoid with potential antioxidant, anti - inflammatory, and anti - cancer properties. It is commonly found in various plants." |
| Effect: | modulate |
| Effect Info: | "Luteolin can directly interact with PPARγ to inhibit its ubiquitination and subsequent proteasomal degradation, thereby treating pathological cardiac hypertrophy and heart failure." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 36998980 |
| Sentence Index: | 36998980_9 |
| Sentence: | Cross analysis of large-scale transcriptomics and drug-target interacting investigations indicated that peroxisome proliferator activated receptor gamma (PPARgamma) was the direct target of luteolin in the setting of pathological cardiac hypertrophy and metabolic disorders. |
Sequence & Structure:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | D | Hypercholesterolemia | Acetylation | 36453279 |
| - | - | D | Atherosclerosis | Acetylation | 36453279 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
