| Id: | acc4885 |
| Group: | 1sens |
| Protein: | PLB |
| Gene Symbol: | Pln |
| Protein Id: | P61014 |
| Protein Name: | PPLA_MOUSE |
| PTM: | phosphorylation |
| Site: | Thr17 |
| Site Sequence: | TRSAIRRASTIEMPQQARQNL |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Cardiac Dysfunction |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Vidarabine |
| Drug Info: | Vidarabine is an antiviral drug used to treat certain viral infections. |
| Effect: | modulate |
| Effect Info: | "PLN phosphorylation (at Thr - 17) leads to a large - scale production of reactive oxygen species (ROS) in the sarcoplasmic reticulum and Ca2+ leakage, thereby resulting in cardiac insufficiency in patients with Parkinson's disease (PD)." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 37558983 |
| Sentence Index: | 37558983_4 |
| Sentence: | The PG-LPS-induced cardiac dysfunction was associated with activation of cyclic AMP/Ca2+-calmodulin-dependent protein kinase II signaling and increased phospholamban phosphorylation at threonine 17. |
Sequence & Structure:
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
