| Id: | acc4896 |
| Group: | 1sens |
| Protein: | GSK3beta |
| Gene Symbol: | Gsk3b |
| Protein Id: | Q9WV60 |
| Protein Name: | GSK3B_MOUSE |
| PTM: | phosphorylation |
| Site: | Ser9 |
| Site Sequence: | -MSGRPRTTSFAESCKPVQQP |
| Disease Category: | Infectious diseases |
| Disease: | Melioidosis |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | chloroquine+ doxycycline |
| Drug Info: | "Chloroquine is a medication used to prevent and treat malaria in certain regions where malaria remains sensitive. It also has immunomodulatory effects and has been investigated for other uses such as in the treatment of autoimmune diseases. | Doxycycline is a broad - spectrum antibiotic of the tetracycline class. It is commonly used to treat a wide variety of bacterial infections, including respiratory tract infections, acne, and tick - borne diseases. " |
| Effect: | modulate |
| Effect Info: | "Chloroquine treatment induces the phosphorylation of GSK3beta at the Ser9 site through the Akt pathway, thereby inhibiting its activity. When used in combination with doxycycline, this adjuvant therapy can suppress pro-inflammatory cytokines and improve the survival rate of patients with melioidosis." |
| Note: | drug comb |
| Score: | 4.0 |
| Pubmed(PMID): | 33612800 |
| Sentence Index: | 33612800_8 |
| Sentence: | "B. pseudomallei-infected mice subjected to adjunct treatment with chloroquine and doxycycline significantly (P<0.05) reduced serum levels of pro-inflammatory cytokines (TNF-alpha, IFN-gamma and IL-6) but increased levels of antiinflammatory cytokines (IL-4 and IL-10)." |
Sequence & Structure:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
