Id: | acc4926 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63085 |
Protein Name: | MK01_MOUSE |
PTM: | phosphorylation |
Site: | Thr185 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Cancer |
Disease: | Lung Cancer |
Disease Subtype: | Pulmonary Carcinomas |
Disease Cellline: | |
Disease Info: | |
Drug: | U0126 |
Drug Info: | "U0126 is a specific drug, but without further context, a detailed description cannot be provided. " |
Effect: | modulate |
Effect Info: | "The MEK1/2 inhibitor U0126 or MEK1/2 siRNA can inhibit the phosphorylation of ERK1/2, indicating that the MAPK pathway is effectively blocked, which may then relieve the negative regulation of LXR or IFN-gamma expression." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 24947959 |
Sentence Index: | 24947959_11 |
Sentence: | "U0126 also inhibited chemicals-induced pulmonary carcinomas, which was associated with increased IFN-gamma expression in the lung." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | D | EL4 thymoma | Phosphorylation | 10753946 |
T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.