Id: | acc4937 |
Group: | 1sens |
Protein: | SMAD3 |
Gene Symbol: | Smad3 |
Protein Id: | Q8BUN5 |
Protein Name: | SMAD3_MOUSE |
PTM: | phosphorylation |
Site: | Ser423 |
Site Sequence: | MGSPSIRCSSVS--------- |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Pulmonary Hypertension |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | fasudil |
Drug Info: | Fasudil is a rho - kinase inhibitor. It is used to improve cerebrovascular spasm after subarachnoid hemorrhage and has potential applications in the treatment of other vascular - related diseases. |
Effect: | modulate |
Effect Info: | "Fasudil indirectly inhibits TGF-beta1-mediated Smad2/3 phosphorylation by suppressing the activity of the RhoA/ROCK pathway, thereby alleviating manifestations of pulmonary fibrosis (PF) and pulmonary hypertension (PH), including elevated right ventricular systolic pressure and pulmonary vascular remodeling. This suggests that the RhoA/ROCK–TGF-beta1–Smad2/3 axis is coupled in PF/PH, and inhibiting this pathway holds therapeutic potential." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 23928001 |
Sentence Index: | 23928001_0 |
Sentence: | Long-term treatment with fasudil improves bleomycin-induced pulmonary fibrosis and pulmonary hypertension via inhibition of Smad2/3 phosphorylation. |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 204 | D | Obesity | Phosphorylation | 29700281 |
- | - | D | Chronic kidney disease | Phosphorylation | 23264657 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.