Id: acc5002
Group: 1sens
Protein: YAP
Gene Symbol: YAP1
Protein Id: P46937
Protein Name: YAP1_HUMAN
PTM: phosphorylation
Site: Ser127
Site Sequence: LTPQHVRAHSSPASLQLGAVS
Disease Category: Urinary and reproductive system diseases
Disease: Renal Fibrosis
Disease Subtype:
Disease Cellline: HK-2
Disease Info:
Drug: GW4064
Drug Info: GW4064 is a selective agonist of the farnesoid X receptor (FXR). It has potential applications in research related to bile acid metabolism and liver diseases.
Effect: modulate
Effect Info: "GW4064 activates FXR, enhances the phosphorylation of YAP at Ser127, promotes its cytoplasmic retention, and inhibits fibrosis."
Note:
Score: 4.0
Pubmed(PMID): 31298930
Sentence Index:
Sentence:

Sequence & Structure:

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC
YAP1-Ser127
Cancer Intensity
BRCA
COAD 0.729
HGSC -1.387
ccRCC
GBM
HNSC 0.735
LUAD -0.077
LUSC
non_ccRCC
PDAC
UCEC

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 127 A Hepatocellular carcinoma/hepatocarcinoma/hepatoma Phosphorylation 22761457
S 127 A Adult T-cell leukemia/lymphoma Phosphorylation 35210364
S 127 D Bladder cancer Phosphorylation 26119935
S 127 D Glioblastoma Phosphorylation 34343153
S 127 D Prostate cancer Phosphorylation 36823643
S 127 D Lung cancer/carcinoma Phosphorylation 21060948
S 127 D Renal cell carcinoma Phosphorylation 32926756
S 127 D Liver cancer Phosphorylation 28474680
S 127 D Diabetes mellitus Phosphorylation 28474680
S 127 D Coronary artery disease Phosphorylation 37104914
S 127 P Cervical cancer/carcinoma Phosphorylation 23027127
S 127 P Hepatocellular cancer Phosphorylation 35597479
S 127 P Colon cancer Phosphorylation 34206989
S 127 U Hepatocellular cancer Phosphorylation 35586495
S 127 U Parkinson's disease Phosphorylation 32929029
S 127 U Osteoarthritis Phosphorylation 37100374
S 127 U Breast cancer Phosphorylation 36774339

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: