| Id: | acc5013 |
| Group: | 1sens |
| Protein: | MGMT |
| Gene Symbol: | Mgmt |
| Protein Id: | P24528 |
| Protein Name: | MGMT_RAT |
| PTM: | methylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Cancer |
| Disease: | Liver Cancer |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | thyroxine |
| Drug Info: | "Thyroxine, also known as tetraiodothyronine (T4), is a thyroid hormone produced by the thyroid gland. It plays a crucial role in regulating the body's metabolic rate and various physiological processes." |
| Effect: | modulate |
| Effect Info: | Elevated MGMT modification can resist DNA damage induced by dimethylnitrosamine and reduce the risk of carcinogenesis; treatment with growth hormone or thyroxine can increase it. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 6825117 |
| Sentence Index: | 6825117_2 |
| Sentence: | The amount of the renal O6-methylguanine-DNA methyltransferase was increased up to 2.5-fold during renal hypertrophy in response to unilateral nephrectomy or treatment with folic acid. |
Sequence & Structure:
MAEICKMKYTVLDSPLGKIELSGCERGLHGIRFLSGKTPNTDPTEAPACPEVLGGPEGVPEPLVQCTAWLEAYFHEPAATEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGEMVSYQQLAALAGNPKAARAVGGAMRSNPVPILIPCHRVIRSDGAIGNYSGGGQTVKEWLLAHEGIPTGQPASKGLGLIGSWLKPSFESSSPKPSG
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
