Id: | acc5070 |
Group: | 1sens |
Protein: | c-Jun |
Gene Symbol: | JUN |
Protein Id: | P05412 |
Protein Name: | JUN_HUMAN |
PTM: | acetylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Immune system diseases |
Disease: | Rheumatoid Arthritis |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Resveratrol |
Drug Info: | "Resveratrol is a polyphenolic compound found in various plants, such as grapes and peanuts. It has antioxidant and anti - inflammatory properties and is being researched for potential health benefits including cardiovascular protection and anti - aging effects." |
Effect: | modulate |
Effect Info: | "BK induces the acetylation of NF-kappaB p65 and AP-1 (c-Jun/c-Fos), further increasing their binding ability to the COX-3 promoter, thereby amplifying the inflammatory response." |
Note: | inducer |
Score: | 4.0 |
Pubmed(PMID): | 28288820 |
Sentence Index: | 28288820_0 |
Sentence: | Resveratrol inhibits BK-induced COX-2 transcription by suppressing acetylation of AP-1 and NF-kappaB in human rheumatoid arthritis synovial fibroblasts. |
Sequence & Structure:
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
JUNB-Lys240 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.141 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | 0.726 | ||||
LUSC | 0.415 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
JUNB-Lys284 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.707 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | 0.707 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
JUNB-Lys36 | |
---|---|
Cancer | Intensity |
BRCA | 0.085 |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | |
LUAD | -1.04 |
LUSC | 0.955 |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | D | Airway fibrosis | Acetylation | 34011384 |
- | - | P | Myeloma | Phosphorylation | 23175437 |
- | - | U | Airway fibrosis | Acetylation | 34011384 |
- | - | U | Osteogenic sarcoma/osteosarcoma | Phosphorylation | 24025361 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.