Id: | acc5071 |
Group: | 1sens |
Protein: | c-Fos |
Gene Symbol: | FOS |
Protein Id: | P01100 |
Protein Name: | FOS_HUMAN |
PTM: | acetylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Immune system diseases |
Disease: | Rheumatoid Arthritis |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Resveratrol |
Drug Info: | "Resveratrol is a polyphenolic compound found in various plants, such as grapes and peanuts. It has antioxidant and anti - inflammatory properties and is being researched for potential health benefits including cardiovascular protection and anti - aging effects." |
Effect: | modulate |
Effect Info: | "BK induces the acetylation of NF-kappaB p65 and AP-1 (c-Jun/c-Fos), further increasing their binding ability to the COX-3 promoter, thereby amplifying the inflammatory response." |
Note: | inducer |
Score: | 4.0 |
Pubmed(PMID): | 28288820 |
Sentence Index: | 28288820_0 |
Sentence: | Resveratrol inhibits BK-induced COX-2 transcription by suppressing acetylation of AP-1 and NF-kappaB in human rheumatoid arthritis synovial fibroblasts. |
Sequence & Structure:
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
FOS-Lys113 | |
---|---|
Cancer | Intensity |
BRCA | -0.27 |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | |
LUAD | -0.837 |
LUSC | 1.107 |
non_ccRCC | |
PDAC | |
UCEC |
FOS-Lys128 | |
---|---|
Cancer | Intensity |
BRCA | -1.155 |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | |
LUAD | 0.581 |
LUSC | 0.574 |
non_ccRCC | |
PDAC | |
UCEC |
FOSL2-Lys222 | |
---|---|
Cancer | Intensity |
BRCA | -1.405 |
COAD | |
HGSC | |
ccRCC | |
GBM | -0.119 |
HNSC | |
LUAD | -0.355 |
LUSC | 0.694 |
non_ccRCC | |
PDAC | |
UCEC | 1.185 |
FOSL2-Lys240 | |
---|---|
Cancer | Intensity |
BRCA | -1.324 |
COAD | |
HGSC | |
ccRCC | |
GBM | 1.178 |
HNSC | |
LUAD | -0.655 |
LUSC | 0.167 |
non_ccRCC | |
PDAC | |
UCEC | 0.634 |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.