| Id: | acc5074 |
| Group: | 1sens |
| Protein: | c-Fos |
| Gene Symbol: | FOS |
| Protein Id: | P01100 |
| Protein Name: | FOS_HUMAN |
| PTM: | phosphorylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Immune system diseases |
| Disease: | Rheumatoid Arthritis |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Resveratrol |
| Drug Info: | "Resveratrol is a polyphenolic compound found in various plants, such as grapes and peanuts. It has antioxidant and anti - inflammatory properties and is being researched for potential health benefits including cardiovascular protection and anti - aging effects." |
| Effect: | modulate |
| Effect Info: | "Resveratrol exerts an anti - inflammatory effect by upregulating Sirt1 and inhibiting the phosphorylation and acetylation of p65 (a subunit of NF - kappaB), c - Jun, and c - Fos (subunits of AP - 1) induced by BK. It has emerged as a potential drug for the treatment of inflammatory arthritis." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 28288820 |
| Sentence Index: | 28288820_0 |
| Sentence: | Resveratrol inhibits BK-induced COX-2 transcription by suppressing acetylation of AP-1 and NF-kappaB in human rheumatoid arthritis synovial fibroblasts. |
Sequence & Structure:
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
| FOS-Ser122 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | |
| GBM | |
| HNSC | 0.476 |
| LUAD | 0.673 |
| LUSC | -1.149 |
| non_ccRCC | |
| PDAC | |
| UCEC | |
| FOS-Ser133 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | |
| GBM | |
| HNSC | 0.707 |
| LUAD | |
| LUSC | -0.707 |
| non_ccRCC | |
| PDAC | |
| UCEC | |
| FOS-Ser258 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | |
| GBM | |
| HNSC | |
| LUAD | -0.637 |
| LUSC | -0.516 |
| non_ccRCC | |
| PDAC | 1.153 |
| UCEC | |
| FOSB-Ser244 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | 0.477 |
| GBM | |
| HNSC | |
| LUAD | 0.916 |
| LUSC | -1.391 |
| non_ccRCC | |
| PDAC | |
| UCEC | -0.002 |
| FOSB-Thr151 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | 1.134 |
| GBM | |
| HNSC | |
| LUAD | -0.754 |
| LUSC | -0.38 |
| non_ccRCC | |
| PDAC | |
| UCEC | |
| FOSL2-Ser120 | |
|---|---|
| Cancer | Intensity |
| BRCA | 0.037 |
| COAD | 0.522 |
| HGSC | -2.803 |
| ccRCC | 0.382 |
| GBM | 0.529 |
| HNSC | 0.203 |
| LUAD | -0.163 |
| LUSC | -0.505 |
| non_ccRCC | 0.531 |
| PDAC | 0.506 |
| UCEC | 0.762 |
| FOSL2-Ser16 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | 0.707 |
| HGSC | -0.707 |
| ccRCC | |
| GBM | |
| HNSC | |
| LUAD | |
| LUSC | |
| non_ccRCC | |
| PDAC | |
| UCEC | |
| FOSL2-Ser19 | |
|---|---|
| Cancer | Intensity |
| BRCA | 1.429 |
| COAD | -0.137 |
| HGSC | -0.197 |
| ccRCC | |
| GBM | -0.141 |
| HNSC | -0.169 |
| LUAD | 0.57 |
| LUSC | 0.357 |
| non_ccRCC | 0.06 |
| PDAC | -2.439 |
| UCEC | 0.667 |
| FOSL2-Ser194 | |
|---|---|
| Cancer | Intensity |
| BRCA | 1.228 |
| COAD | |
| HGSC | |
| ccRCC | |
| GBM | -0.162 |
| HNSC | -0.187 |
| LUAD | 0.468 |
| LUSC | 0.279 |
| non_ccRCC | 0.016 |
| PDAC | -2.197 |
| UCEC | 0.554 |
| FOSL2-Ser200 | |
|---|---|
| Cancer | Intensity |
| BRCA | 0.173 |
| COAD | 0.178 |
| HGSC | -0.26 |
| ccRCC | 0.635 |
| GBM | 1.093 |
| HNSC | -0.433 |
| LUAD | -0.983 |
| LUSC | -1.252 |
| non_ccRCC | 1.596 |
| PDAC | -1.541 |
| UCEC | 0.794 |
| FOSL2-Ser211 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | -0.492 |
| GBM | |
| HNSC | 1.071 |
| LUAD | 1.074 |
| LUSC | -0.611 |
| non_ccRCC | |
| PDAC | |
| UCEC | -1.041 |
| FOSL2-Ser215 | |
|---|---|
| Cancer | Intensity |
| BRCA | 1.225 |
| COAD | |
| HGSC | |
| ccRCC | -1.019 |
| GBM | |
| HNSC | -0.071 |
| LUAD | -1.573 |
| LUSC | 0.915 |
| non_ccRCC | |
| PDAC | 0.201 |
| UCEC | 0.322 |
| FOSL2-Ser230 | |
|---|---|
| Cancer | Intensity |
| BRCA | 2.331 |
| COAD | 0.21 |
| HGSC | 0.957 |
| ccRCC | -0.087 |
| GBM | 0.304 |
| HNSC | -0.661 |
| LUAD | -1.208 |
| LUSC | -0.311 |
| non_ccRCC | 0.001 |
| PDAC | -1.178 |
| UCEC | -0.358 |
| FOSL2-Ser232 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | -0.136 |
| ccRCC | 0.577 |
| GBM | |
| HNSC | 0.609 |
| LUAD | 0.642 |
| LUSC | |
| non_ccRCC | |
| PDAC | |
| UCEC | -1.693 |
| FOSL2-Ser235 | |
|---|---|
| Cancer | Intensity |
| BRCA | |
| COAD | |
| HGSC | |
| ccRCC | |
| GBM | |
| HNSC | |
| LUAD | |
| LUSC | 1.058 |
| non_ccRCC | |
| PDAC | -0.129 |
| UCEC | -0.929 |
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
