| Id: | acc5083 |
| Group: | 1sens |
| Protein: | MLC2 |
| Gene Symbol: | Myl2 |
| Protein Id: | P08733 |
| Protein Name: | MLRV_RAT |
| PTM: | phosphorylation |
| Site: | Ser19 |
| Site Sequence: | LEGGSSNVFSMFEQTQIQEFK |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Subarachnoid Hemorrhage |
| Disease Subtype: | |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | SNX-482 |
| Drug Info: | SNX - 482 is a selective blocker of R - type voltage - gated calcium channels. It has potential applications in the study of pain and neurological disorders. |
| Effect: | modulate |
| Effect Info: | "The R-type calcium channel antagonist SNX-482 may improve cerebral blood flow (CBF) after subarachnoid hemorrhage (SAH) by partially inhibiting MLC2 phosphorylation and calmodulin degradation, and its potential may exceed that of L-type calcium channel antagonists. This indicates that R-type calcium channels play a more crucial role in the development and treatment of SAH vasospasm." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 20568961 |
| Sentence Index: | 20568961_8 |
| Sentence: | "Numbers of R-type calcium channels increased following SAH, and neurological deficit, CBF reduction, and enhancement of MLC2 phosphorylation as well as calponin degradation were all found to be present." |
Sequence & Structure:
MSPKKAKKRLEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
