| Id: | acc5114 |
| Group: | 1sens |
| Protein: | PP2B |
| Gene Symbol: | Ppp3ca |
| Protein Id: | P63329 |
| Protein Name: | PP2BA_RAT |
| PTM: | phosphorylation |
| Site: | Ser197 |
| Site Sequence: | AALMNQQFLCVHGGLSPEINT |
| Disease Category: | Nervous system diseases |
| Disease: | Status Epilepticus |
| Disease Subtype: | neuronal death |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | Leptomycin B (LMB) |
| Drug Info: | "Leptomycin B (LMB) is a potent and specific inhibitor of nuclear export. It functions by covalently binding to the nuclear export receptor CRM1, thereby blocking the export of various proteins from the nucleus. " |
| Effect: | modulate |
| Effect Info: | "LMB can upregulate the phosphorylation of PKA and PP2B, activate PKA, inhibit PP2B, and then upregulate ERK1/2, thereby exerting a neuroprotective effect. Combining with CsA can further enhance the phosphorylation of ERK and strengthen the effect of LMB." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 28601633 |
| Sentence Index: | 28601633_8 |
| Sentence: | U0126 (an ERK1/2 inhibitor) co-treatment abolished the protective effect of LMB on SE-induced neuronal death without alterations in PKA and PP2B phosphorylations. |
Sequence & Structure:
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
