Id: | acc5126 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63086 |
Protein Name: | MK01_RAT |
PTM: | phosphorylation |
Site: | Thr185 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Nervous system diseases |
Disease: | Spinal Cord Injury |
Disease Subtype: | primary traumatic spinal cord injury |
Disease Cellline: | |
Disease Info: | |
Drug: | C225 |
Drug Info: | "C225, also known as cetuximab, is a monoclonal antibody used in cancer treatment. It targets the epidermal growth factor receptor (EGFR) to inhibit tumor cell growth and proliferation." |
Effect: | modulate |
Effect Info: | "Inhibition of EGFR phosphorylation using C225 or AG1478, and significant EGFR blockade reduced MAPK activation, decreased nerve inflammation-related damage, and promoted axonal growth and functional recovery." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 22824323 |
Sentence Index: | 22824323_12 |
Sentence: | "Subsequently, seven-day continual infusion of C225 or AG1478 in rats: reduced the expression of phospho-EGFR, phosphorylation of Erk and p38 MAPK, and production of IL-1 beta and TNF alpha; lessened neuroinflammation-associated secondary damage, like microglia/astrocyte activation, tissue edema and glial scar/cavity formation; and enhanced axonal outgrowth and functional recovery." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.