Id: | acc5143 |
Group: | 1sens |
Protein: | p38 MAPK |
Gene Symbol: | Mapk14 |
Protein Id: | P70618 |
Protein Name: | MK14_RAT |
PTM: | phosphorylation |
Site: | Thr180 |
Site Sequence: | LARHTDDEMTGYVATRWYRAP |
Disease Category: | Nervous system diseases |
Disease: | Spinal Cord Injury |
Disease Subtype: | primary traumatic spinal cord injury |
Disease Cellline: | |
Disease Info: | |
Drug: | AG1478 |
Drug Info: | "AG1478 is a potent and selective inhibitor of the epidermal growth factor receptor (EGFR) tyrosine kinase, which has been widely used in cancer research to study the role of EGFR signaling pathways." |
Effect: | modulate |
Effect Info: | "Inhibition of EGFR phosphorylation using C225 or AG1478, and significant EGFR blockade reduced MAPK activation, decreased nerve inflammation-related damage, and promoted axonal growth and functional recovery." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 22824323 |
Sentence Index: | 22824323_12 |
Sentence: | "Subsequently, seven-day continual infusion of C225 or AG1478 in rats: reduced the expression of phospho-EGFR, phosphorylation of Erk and p38 MAPK, and production of IL-1 beta and TNF alpha; lessened neuroinflammation-associated secondary damage, like microglia/astrocyte activation, tissue edema and glial scar/cavity formation; and enhanced axonal outgrowth and functional recovery." |
Sequence & Structure:
MSQERPTFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAEPYDQSFESRDFLIDEWKSLTYDEVISFVPPPLDQEEMES
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.