| Id: | acc5155 |
| Group: | 1sens |
| Protein: | ERK2 |
| Gene Symbol: | Mapk1 |
| Protein Id: | P63086 |
| Protein Name: | MK01_RAT |
| PTM: | phosphorylation |
| Site: | Tyr187 |
| Site Sequence: | HTGFLTEYVATRWYRAPEIML |
| Disease Category: | Nervous system diseases |
| Disease: | Neuronal Damage |
| Disease Subtype: | Kainic Acid-Induced Excitotoxic Injury |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | silymarin |
| Drug Info: | Silymarin is a natural mixture of flavonolignans extracted from the milk thistle plant. It is known for its hepatoprotective properties and is commonly used to support liver health. |
| Effect: | modulate |
| Effect Info: | "Silymarin inhibits the phosphorylation of ERK1/2 and enhances the phosphorylation of Akt, thereby reducing glutamate release and alleviating excitotoxicity." |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 33182349 |
| Sentence Index: | 33182349_7 |
| Sentence: | "Moreover, systemic treatment of rats with silymarin (50 or 100 mg/kg) 30 min before systemic KA (15 mg/kg) administration attenuated KA-induced seizures, glutamate concentration elevation, neuronal damage, glial activation, and heat shock protein 70 expression as well as upregulated KA-induced decrease in Akt phosphorylation in the rat hippocampus." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | A | Basophilic leukemia | Phosphorylation | 11971018 |
| T | 183 | D | Major depressive disorder | Phosphorylation | 16959794 |
| Y | 185 | D | Major depressive disorder | Phosphorylation | 16959794 |
| T | 183 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
| Y | 185 | U | Uteroplacental insufficiency | Phosphorylation | 16940436 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
