| Id: | acc5161 |
| Group: | 1sens |
| Protein: | Histone H3 |
| Gene Symbol: | H3c1 |
| Protein Id: | P68433 |
| Protein Name: | H31_MOUSE |
| PTM: | acetylation |
| Site: | unclear |
| Site Sequence: | |
| Disease Category: | Respiratory system diseases |
| Disease: | Acute Lung Injury |
| Disease Subtype: | sepsis-induced acute lung injury |
| Disease Cellline: | J774A.1 |
| Disease Info: | |
| Drug: | Colchicine |
| Drug Info: | Colchicine is an alkaloid drug. It is commonly used in the treatment of gout and familial Mediterranean fever. |
| Effect: | modulate |
| Effect Info: | "Colchicine inhibits the phosphorylation of STAT3 and prevents its binding to the histone acetyltransferase EP300, thereby indirectly suppressing the acetylation levels of H3/H4 at the NLRP3 promoter, reducing the activity of the NLRP3 inflammasome and pyroptosis." |
| Note: | histone |
| Score: | 3.0 |
| Pubmed(PMID): | 37115345 |
| Sentence Index: | 37115345_0 |
| Sentence: | Inhibition of STAT3 phosphorylation by colchicine regulates NLRP3 activation to alleviate sepsis-induced acute lung injury. |
Sequence & Structure:
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
