| Id: | acc5165 |
| Group: | 1sens |
| Protein: | PP2A |
| Gene Symbol: | Ppp2ca |
| Protein Id: | P63330 |
| Protein Name: | PP2AA_MOUSE |
| PTM: | methylation |
| Site: | Leu309 |
| Site Sequence: | VTRRTPDYFL----------- |
| Disease Category: | Cardiovascular and circulatory system diseases |
| Disease: | Cardiac Dysfunction |
| Disease Subtype: | Sepsis-Associated Cardiac Dysfunction |
| Disease Cellline: | |
| Disease Info: | |
| Drug: | LPS |
| Drug Info: | "LPS (Lipopolysaccharide) is a major component of the outer membrane of Gram - negative bacteria, which can trigger a strong immune response in the host organism." |
| Effect: | modulate |
| Effect Info: | "LPS treatment decreased the expression of the catalytic subunit and the B56alpha regulatory subunit of PP2A and increased its demethylated form, resulting in a decrease in PP2A activity and indirectly enhancing cTnI phosphorylation and the inhibitory effect on cardiac function." |
| Note: | inducer |
| Score: | 3.0 |
| Pubmed(PMID): | 19201758 |
| Sentence Index: | 19201758_1 |
| Sentence: | AIMS: Sepsis-associated cardiac dysfunction represents an intrinsic impairment of cardiomyocyte function due in part to a decrease in myofilament Ca(2+) sensitivity associated with a sustained increase in cardiac troponin I (cTnI) phosphorylation at Ser23/24. |
Sequence & Structure:
MDEKLFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
