Id: | acc5175 |
Group: | 1sens |
Protein: | ERK2 |
Gene Symbol: | Mapk1 |
Protein Id: | P63085 |
Protein Name: | MK01_MOUSE |
PTM: | phosphorylation |
Site: | Thr185 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Cardiovascular and circulatory system diseases |
Disease: | Cardiomyopathy |
Disease Subtype: | septic cardiomyopathy |
Disease Cellline: | |
Disease Info: | |
Drug: | hydrogen therapy |
Drug Info: | "Hydrogen therapy is a treatment approach that involves the use of molecular hydrogen. It is thought to exert antioxidant, anti - inflammatory, and anti - apoptotic effects through various biological mechanisms. " |
Effect: | modulate |
Effect Info: | "Hydrogen pretreatment can inhibit lipopolysaccharide (LPS)-induced phosphorylation of extracellular signal-regulated kinase 1/2 (ERK1/2), thereby attenuating myocardial inflammatory responses and improving cardiac function, as manifested by an increased ejection fraction and improved myocardial structure. This suggests that hydrogen pretreatment has a negative regulatory effect on the mitogen-activated protein kinase (MAPK) pathway." |
Note: | Non-conventional drugs |
Score: | 3.0 |
Pubmed(PMID): | 31440160 |
Sentence Index: | 31440160_13 |
Sentence: | "Furthermore, pretreatment with hydrogen resulted in cardioprotection during septic cardiomyopathy via inhibiting the expression of pro-inflammatory cytokines TNFalpha, IL-1beta, and IL-18; suppressing the phosphorylation of ERK1/2, p38, and JNK; and reducing the nuclear translocation of NF-kappaB and the expression of TLR4 by LPS." |
Sequence & Structure:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | D | EL4 thymoma | Phosphorylation | 10753946 |
T | 183 | U | Mammary tumor/carcinoma | Phosphorylation | 12754301 |
T | 188 | U | Heart failure | Phosphorylation | 19060905 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.